Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial (Active)
This Recombinant Human Immunoglobulin heavy constant epsilon (IGHE), partial (Active) spans the amino acid sequence from region 104-427aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin heavy constant epsilon; Ig epsilon chain C region; Ig epsilon chain C region ND; IGHE
UniProt
P01854
Expression Region
104-427aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human IGHE at 2 μg/mL can bind Anti-IGHE recombinant antibody. The EC50 is 3.097-4.487 ng/mL.
Form
Lyophilized powder
Molecular Weight
38.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
VCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470768-100 1x 100 µL
GnRH-Receptor (LHRH Receptor) (GNRHR/768), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details