Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active)
This Recombinant Mouse Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (Itpripl1), partial (Active) spans the amino acid sequence from region 23-96aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1; Itpripl1
UniProt
A2ASA8
Expression Region
23-96aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Mus musculus (Mouse)
Field of Research
Pharmacology & Drug Discovery
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Itpripl1 at 2 μg/mL can bind Anti-ITPRIPL1 recombinant antibody. The EC50 is 0.7534-0.9877 ng/mL.
Form
Lyophilized powder
Molecular Weight
10.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680139-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (57), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401166-100 1x 100 µL
PAX6 (PAX6/1166), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041714-100 1x 100 µL
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/1714), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882416-500 1x 500 µL
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040803-500 1x 500 µL
Cytokeratin 8 (KRT8/803), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details