Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2), Biotinylated spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maleimide Coated PCR 8 Strip Tubes
PCR22-MAL 100 Units

Maleimide Coated PCR 8 Strip Tubes

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF640R conjugate, 0.1mg/mL
BNC402207-500 1x 500 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bml-210
SIH-348-5MG 5 mg

Bml-210

Sign In for Pricing
View Details
ERI2 (Center) Rabbit Polyclonal Antibody
AP51456PU-N 400 µL

ERI2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac 6Beta-Hydroxy Norgestrel
TRC-H825700-50MG 50 mg

rac 6Beta-Hydroxy Norgestrel

Sign In for Pricing
View Details
MMAE Rabbit Monoclonal Antibody [Clone ID: 11B2]
TA421194S 10 µg

MMAE Rabbit Monoclonal Antibody [Clone ID: 11B2]

Sign In for Pricing
View Details