Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial

This Recombinant Human Vitamin K epoxide reductase complex subunit 1 (VKOR1), partial spans the amino acid sequence from region 30-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin K epoxide reductase complex subunit 1; EC 1.17.4.4; Vitamin K1 2,3-epoxide reductase subunit 1; VKORC1 VKOR MSTP134 MSTP576 UNQ308/PRO351

UniProt

Q9BQB6

Expression Region

30-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KAARARDRDYRALCDVGTAISCSRVFSSRWGRGFGLVEHVLGQDSILNQSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tepoditamab (Anti-CLEC12A / CD371)
A2542-1mg*5 5x 1mg

Tepoditamab (Anti-CLEC12A / CD371)

Sign In for Pricing
View Details
Recombinant Human HDAC8/ HDACL1 Protein, His-SUMO, E.coli-10ug
QP6155-ec-10ug 10ug

Recombinant Human HDAC8/ HDACL1 Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
R-Spondin-2 Recombinant Protein
orb1230467 5 µg

R-Spondin-2 Recombinant Protein

Sign In for Pricing
View Details
Meis2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6626203 1.0 µg DNA

Meis2 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Mouse Monoclonal Mer Antibody (125518) [mFluor Violet 450 SE]
FAB8912MFV450 0.1 mL

Mouse Monoclonal Mer Antibody (125518) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Phospho-AMOT (S1041) Antibody
E45R05240G-1 100 µL

Phospho-AMOT (S1041) Antibody

Sign In for Pricing
View Details