Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-5 (SNX5)

This Recombinant Human Sorting nexin-5 (SNX5) spans the amino acid sequence from region 2-404. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-5 SNX5

UniProt

Q9Y5X3

Expression Region

2-404

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMCH1 (NM_014988) Human Recombinant Protein
E45H34533M5 20 µg

LIMCH1 (NM_014988) Human Recombinant Protein

Sign In for Pricing
View Details
DSTN (Destrin) (8W17) Mouse Monoclonal antibody
E28PE3170 100 µL

DSTN (Destrin) (8W17) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial
MBS1327061-01 0.05 mg (E-Coli)

Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial

Sign In for Pricing
View Details
Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial
MBS1327061-02 0.05 mg (Yeast)

Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial

Sign In for Pricing
View Details
Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial
MBS1327061-03 0.05 mg (Baculovirus)

Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial

Sign In for Pricing
View Details
Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial
MBS1327061-04 0.2 mg (E-Coli)

Recombinant Human Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2) , partial

Sign In for Pricing
View Details