Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11)

This Recombinant Human Probable non-functional T cell receptor gamma variable 11 (TVG11) spans the amino acid sequence from region 19-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor gamma variable 11 TRGV11

UniProt

A0A075B6L2

Expression Region

19-119

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLEQPEISISRPANKSAHISWKASIQGFSSKIIHWYWQKPNKGLEYLLHVFLTISAQDCSGGKTKKLEVSKNAHTSTSTLKIKFLEKEDEVVYHCACWIRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FMN2 Antibody
MBS9403047-01 0.05 mL

FMN2 Antibody

Sign In for Pricing
View Details
FMN2 Antibody
MBS9403047-02 0.1 mL

FMN2 Antibody

Sign In for Pricing
View Details
FMN2 Antibody
MBS9403047-03 5x 0.1 mL

FMN2 Antibody

Sign In for Pricing
View Details
TM2D3 Recombinant Protein (Human)
RP031705 100 µg

TM2D3 Recombinant Protein (Human)

Sign In for Pricing
View Details
Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61685R-BF488-TR 20 µL

Atrial natriuretic factor Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
LOC100365660 3'UTR Luciferase Stable Cell Line
TU209590 1.0 mL

LOC100365660 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details