Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118)

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX20 ORF Vector (Human) (pORF)
ORF009871 1.0 µg DNA

SNX20 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Klotho
100-346 20 µg

Klotho

Sign In for Pricing
View Details
Lentiviral human S100P shRNA (UAS) - Lentiviral human S100P shRNA (UAS) plasmid
GTR15332782 1 Vial

Lentiviral human S100P shRNA (UAS) - Lentiviral human S100P shRNA (UAS) plasmid

Sign In for Pricing
View Details
SIPA1L2 Polyclonal Antibody, HRP Conjugated
A60917-050 50 µL

SIPA1L2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Cpeb4 3'UTR Lenti-reporter-Luc Vector
16748084 1.0 µg

Cpeb4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Siah3 Mouse shRNA Plasmid (Locus ID 380918)
TL518794 1 Kit

Siah3 Mouse shRNA Plasmid (Locus ID 380918)

Sign In for Pricing
View Details