Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-18 (HV118)

This Recombinant Human Immunoglobulin heavy variable 1-18 (HV118) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-18 IGHV1-18

UniProt

A0A0C4DH31

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-S. enterica serovar Typhi, Typhoid polysaccharide Antibody IgG, Vi IgG ELISA KIT
ED0017Ra-01 96 Well

Rat Anti-S. enterica serovar Typhi, Typhoid polysaccharide Antibody IgG, Vi IgG ELISA KIT

Sign In for Pricing
View Details
Rat Colon OptiTDS™1: Tissue Dissociation System
4-28236 1 Kit

Rat Colon OptiTDS™1: Tissue Dissociation System

Sign In for Pricing
View Details
PlsX Antibody
orb823962 2 mg

PlsX Antibody

Sign In for Pricing
View Details
Sppl2a Protein Vector (Human) (pPB-N-His)
PV039970 500 ng

Sppl2a Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
MYOF Rabbit pAb
E45R21989N-100 100 µL

MYOF Rabbit pAb

Sign In for Pricing
View Details
Mouse Eukaryotic Translation Initiation Factor 2 Alpha Kinase 3 (EIF2aK3) ELISA Kit
RD-EIF2aK3-Mu-96Tests 96 Tests

Mouse Eukaryotic Translation Initiation Factor 2 Alpha Kinase 3 (EIF2aK3) ELISA Kit

Sign In for Pricing
View Details