Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ASNSD1 upstream open reading frame protein (ASURF)

This Recombinant Human ASNSD1 upstream open reading frame protein (ASURF) spans the amino acid sequence from region 1-96. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASNSD1 upstream open reading frame protein; ASNSD1 small/short open reading frame-encoded polypeptide; ASNSD1-SEP; ASDURF

UniProt

L0R819

Expression Region

1-96

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIFFLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Glucokinase/GCK Antibody (OTI3E3) [FITC]
NBP2-70822F 0.1 mL

Mouse Monoclonal Glucokinase/GCK Antibody (OTI3E3) [FITC]

Sign In for Pricing
View Details
SLC45A4 Protein Vector (Mouse) (pPB-N-His)
PV231003 500 ng

SLC45A4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Mindy3 shRNA (UAS) - Lentiviral mouse Mindy3 shRNA (UAS, RFP) (100)
GTR15274056 1 Vial

Lentiviral mouse Mindy3 shRNA (UAS) - Lentiviral mouse Mindy3 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Rabbit Monoclonal TACI/TNFRSF13B/CVID Antibody (006) [PerCP]
NBP2-90025PCP 0.1 mL

Rabbit Monoclonal TACI/TNFRSF13B/CVID Antibody (006) [PerCP]

Sign In for Pricing
View Details
METTL14 sgRNA CRISPR Lentivector set (Human)
K1294801 3x 1.0 µg

METTL14 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 polyclonal Antibody
MBS711019-01 0.1 mL

Rabbit anti-human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 polyclonal Antibody

Sign In for Pricing
View Details