Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial, Biotinylated

This Recombinant Human SLCO1B3-SLCO1B7 readthrough transcript protein (SO1BT), partial, Biotinylated spans the amino acid sequence from region 431-539. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLCO1B3-SLCO1B7 readthrough transcript protein; Liver specific transporter-3 transmembrane 12; LST-3TM12; Organic anion transporting polypeptide 1B3-1B7; OATP1B3-1B7; Solute carrier organic anion transporter family member 1B3-1B7; SLCO1B3-SLCO1B7; SLCO1B3-SLCO1B7

UniProt

F5H094

Expression Region

431-539

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESKSVAGLTLTYDGNSPVRSHVDVPLSYCNSECNCDESQWEPVCGNNGITYLSPCLAGCKSSSGNKEPIVFYNCSCVEVIGLQNKNYSAHLGECPRDDACTRKSYVYFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF647 conjugate, 0.1mg/mL
BNC472465-500 1x 500 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)
KN420949 1 Kit

PR3 (PRTN3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL
BNC941471-500 1x 500 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS640406 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
1-Ethyl-5-hydroxy-2-pyrrolidinone-d5
TRC-E919177-5MG 5 mg

1-Ethyl-5-hydroxy-2-pyrrolidinone-d5

Sign In for Pricing
View Details
(-)-Dibenzoyl-L-Tartaric Acid Monohydrate
TRC-D422815-1G 1 g

(-)-Dibenzoyl-L-Tartaric Acid Monohydrate

Sign In for Pricing
View Details