Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2, phosphorylated (Ser395) (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) discontinued. See M2800-04G
M2800-06B 50 µg

MDM2, phosphorylated (Ser395) (E3 Ubiquitin-protein Ligase Mdm2, Double Minute 2 Protein, Hdm2, Oncoprotein Mdm2, p53-binding Protein Mdm2) discontinued. See M2800-04G

Sign In for Pricing
View Details
ANKRD26 Polyclonal Antibody
MBS2527142-01 0.02 mL

ANKRD26 Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD26 Polyclonal Antibody
MBS2527142-02 0.06 mL

ANKRD26 Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD26 Polyclonal Antibody
MBS2527142-03 0.12 mL

ANKRD26 Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD26 Polyclonal Antibody
MBS2527142-04 0.2 mL

ANKRD26 Polyclonal Antibody

Sign In for Pricing
View Details
APC Rabbit Polyclonal Antibody (BF405)
orb2427893 100 µL

APC Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details