Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2b tag Antibody
abx019078 100 µg

E2b tag Antibody

Sign In for Pricing
View Details
Rad54 (4E3/1) : m-IgG Fc BP-HRP Bundle
sc-538990 1 Kit

Rad54 (4E3/1) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
ADAMTS4 Mouse Monoclonal Antibody [Clone ID: LBI6F8]
AMM16823V 100 µL

ADAMTS4 Mouse Monoclonal Antibody [Clone ID: LBI6F8]

Sign In for Pricing
View Details
Gja6 Protein Vector (Rat) (pPM-C-HA)
PV270252 500 ng

Gja6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr724 AAV Vector (Mouse) (CMV)
33392104 1 µg

Olfr724 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Mouse FMO5 shRNA Plasmid
abx970375-01 150 µg

Mouse FMO5 shRNA Plasmid

Sign In for Pricing
View Details