Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 7-46 (LV746), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 7-46 IGLV7-46

UniProt

A0A075B6I9

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTSGHYPYWFQQKPGQAPRTLIYDTSNKHSWTPARFSGSLLGGKAALTLLGAQPEDEAEYYCLLSYSGAR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Smad4 Antibody (SMAD/7905R) [DyLight 350]
NBP3-21080UV 0.1 mL

Rabbit Monoclonal Smad4 Antibody (SMAD/7905R) [DyLight 350]

Sign In for Pricing
View Details
DUSP10 Antibody
orb1330052 100 µg

DUSP10 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal CD47 Antibody (CD47/6362R) [Alexa Fluor 532]
NBP3-08218AF532 100 µL

Rabbit Monoclonal CD47 Antibody (CD47/6362R) [Alexa Fluor 532]

Sign In for Pricing
View Details
dNT-2 CRISPR Activation Plasmid (m2)
sc-430495-ACT-2 20 µg

dNT-2 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
C3orf24 Polyclonal Antibody
orb1416240 100 µL

C3orf24 Polyclonal Antibody

Sign In for Pricing
View Details
Vaccinia Capping System
M2080S 400 Units

Vaccinia Capping System

Sign In for Pricing
View Details