Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated

This Recombinant Human NADH dehydrogenase (NDUCR), partial, Biotinylated spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2; NDUFC2-KCTD14 readthrough transcript protein; NDUFC2-KCTD14

UniProt

E9PQ53

Expression Region

1-55

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TH (6A477)
sc-73151 200 µg/mL

TH (6A477)

Sign In for Pricing
View Details
4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole
orb3022632-01 100 mg

4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole

Sign In for Pricing
View Details
4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole
orb3022632-02 5 mg

4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole

Sign In for Pricing
View Details
4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole
orb3022632-03 25 mg

4- (5-Nitro-1H-benzo[d]imidazol-2-yl) thiazole

Sign In for Pricing
View Details
pOTB7-PQBP1 Plasmid
PVT25815 2 µg

pOTB7-PQBP1 Plasmid

Sign In for Pricing
View Details
FTHL8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
57709111 3x 1.0 µg

FTHL8 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details