Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66), Biotinylated

This Recombinant Human Ankyrin repeat domain-containing protein 66 (ANR66), Biotinylated spans the amino acid sequence from region 1-196. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 66 ANKRD66

UniProt

B4E2M5

Expression Region

1-196

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MELAKMSDMTKLHQAVAAGDYSLVKKILKKGLCDPNYKDVDWNDRTPLHWAAIKGQMEVIRLLIEYGARPCLVTSVGWTPAHFAAEAGHLNILKTLHALHAAIDAPDFFGDTPKRIAQIYGQKACVAFLEKAEPECQDHRCAAQQKGLPLDERDEDWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF-1 (C-5) Alexa Fluor® 594
sc-271453 AF594 200 µg/mL

TCF-1 (C-5) Alexa Fluor® 594

Sign In for Pricing
View Details
PLD6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
36967061 1.0 µg DNA

PLD6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PQBP1 (NM_001032383) Human Tagged Lenti ORF Clone
RC224043L4 10 µg

PQBP1 (NM_001032383) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pecr 3'UTR Luciferase Stable Cell Line
TU216068 1.0 mL

Pecr 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GFRAL, CT (GFRAL, C6orf144, GDNF family receptor alpha-like) (AP)
MBS6302017-01 0.2 mL

GFRAL, CT (GFRAL, C6orf144, GDNF family receptor alpha-like) (AP)

Sign In for Pricing
View Details
GFRAL, CT (GFRAL, C6orf144, GDNF family receptor alpha-like) (AP)
MBS6302017-02 5x 0.2 mL

GFRAL, CT (GFRAL, C6orf144, GDNF family receptor alpha-like) (AP)

Sign In for Pricing
View Details