Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pyrin domain-containing protein 5 (PYDC5)

This Recombinant Human Pyrin domain-containing protein 5 (PYDC5) spans the amino acid sequence from region 1-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pyrin domain-containing protein 5; Pyrin domain-only protein 3; PYDC5 POP3

UniProt

W6CW81

Expression Region

1-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MESKYKEILLLTSLDNITDEELDRFKCFLPDEFNIATGKLHTLNSTSSQLDLKRWHGVCSEEDRIFQKLNYMLVAKCLREEQETGICGSPSSARSVSQSRLGLSFHGISGNAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOL3 Antibody - middle region (ARP87288_P050)
ARP87288_P050 100 µL

NOL3 Antibody - middle region (ARP87288_P050)

Sign In for Pricing
View Details
Mouse Adamts18 Pre-designed siRNA Set B
SI100254B 1 Each

Mouse Adamts18 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Maackia amurensis (MAA/MAL I) (FITC)
518514 2 mg

Maackia amurensis (MAA/MAL I) (FITC)

Sign In for Pricing
View Details
Anti-Mouse IL1RN/IL-1ra/IL1F3 Polyclonal Antibody
PMD29701 100 μg

Anti-Mouse IL1RN/IL-1ra/IL1F3 Polyclonal Antibody

Sign In for Pricing
View Details
2,4,7-Trihydroxy-9,10-dihydrophenanthrene
HY-N7155-01 5 mg

2,4,7-Trihydroxy-9,10-dihydrophenanthrene

Sign In for Pricing
View Details
2,4,7-Trihydroxy-9,10-dihydrophenanthrene
HY-N7155-02 25 mg

2,4,7-Trihydroxy-9,10-dihydrophenanthrene

Sign In for Pricing
View Details