Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBDE 175
TRC-P215265-10MG 10 mg

PBDE 175

Sign In for Pricing
View Details
Tissue FFPE Sections, Fallopian tube
CS700028 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF594 conjugate, 0.1mg/mL
BNC940393-100 1x 100 µL

Cytokeratin, multi (C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR2J3 Human Gene Knockout Kit (CRISPR)
KN415580 1 Kit

OR2J3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF568 conjugate, 0.1mg/mL
BNC681819-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rMOC-31), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC12A3 (NM_000339) Human Over-expression Lysate
LY424783 100 µg

SLC12A3 (NM_000339) Human Over-expression Lysate

Sign In for Pricing
View Details