Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4)

This Recombinant Human T cell receptor alpha variable 4 (TVA4) spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orlistate
TBW00853 100mg

Orlistate

Sign In for Pricing
View Details
Graphene Platelet Nanopowder (GPN Type 3)
98585-1 25 Gms

Graphene Platelet Nanopowder (GPN Type 3)

Sign In for Pricing
View Details
Fam100a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7194506 1.0 µg DNA

Fam100a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CDK2 Polyclonal Antibody, PE Conjugated
bs-10726R-PE-TR 20 µL

CDK2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
PRSS56 (NM_001195129) Human Over-expression Lysate
LS646960-20ug 20 µg

PRSS56 (NM_001195129) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp799 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
51136154 3x 1.0 µg DNA

Zfp799 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details