Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Somatostatin receptor type 2 (SSTR2) -VLPs

This Recombinant Human Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-369aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SRIF-1

UniProt

P30874

Expression Region

1-369aa

Tag

C-terminal miRFP670nano3-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

The purity information is not available for VLPs proteins.

Form

Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSX1 antibody
10R-5948 100 µL

SSX1 antibody

Sign In for Pricing
View Details
GPNMB Recombinant Protein (Mouse)
RP139382 100 µg

GPNMB Recombinant Protein (Mouse)

Sign In for Pricing
View Details
BMP6
520629-01 100 µL

BMP6

Sign In for Pricing
View Details
BMP6
520629-02 200 µL

BMP6

Sign In for Pricing
View Details
Anti-A2AR/ADORA2A Antibody (R3H71)
RHD82102 100 μg

Anti-A2AR/ADORA2A Antibody (R3H71)

Sign In for Pricing
View Details
SIK1 Conjugated Antibody
MBS9448399-01 0.1 mL (Biotin)

SIK1 Conjugated Antibody

Sign In for Pricing
View Details