Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis B and T lymphocyte associated (BTLA), partial

This Recombinant Macaca fascicularis B and T lymphocyte associated (BTLA), partial spans the amino acid sequence from region 31-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A2K5W7M7

Expression Region

31-152aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dcstamp (NM_029422) Mouse Tagged ORF Clone Lentiviral Particle
MR224544L4V 200 µL

Dcstamp (NM_029422) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
GLIS3 (NM_001042413) Human Tagged Lenti ORF Clone
RC224097L4 10 µg

GLIS3 (NM_001042413) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olfactory Receptor Family 4 Subfamily A Member 15 (OR4A15) Antibody
abx026544-01 80 µL

Olfactory Receptor Family 4 Subfamily A Member 15 (OR4A15) Antibody

Sign In for Pricing
View Details
Olfactory Receptor Family 4 Subfamily A Member 15 (OR4A15) Antibody
abx026544-02 400 µL

Olfactory Receptor Family 4 Subfamily A Member 15 (OR4A15) Antibody

Sign In for Pricing
View Details
Mex3d Lentiviral Activation Particles (h2)
sc-410666-LAC-2 200 µL

Mex3d Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Rabbit anti-Aggrecan Antibody
MBS4511978-01 0.05 mL

Rabbit anti-Aggrecan Antibody

Sign In for Pricing
View Details