Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flock house virus Protein B2 (B2)

This Recombinant Flock house virus Protein B2 (B2) spans the amino acid sequence from region 1-106aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B2

UniProt

P68831

Expression Region

1-106aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Flock house virus (FHV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEGKAPEEAKPTLEERLRKLELSHSLPTTGSDPPPAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mPEG-Piperazine, 5K
MF001248-5K Inquire

mPEG-Piperazine, 5K

Sign In for Pricing
View Details
Rabbit Monoclonal SPINK4 Antibody (285) [Alexa Fluor 488]
NBP2-89955AF488 0.1 mL

Rabbit Monoclonal SPINK4 Antibody (285) [Alexa Fluor 488]

Sign In for Pricing
View Details
Ardisiphenol A
sc-481262 1 mg

Ardisiphenol A

Sign In for Pricing
View Details
ASO 5+1
A06609H 2x 25 mL Buffer + 1x 10 mL Latex

ASO 5+1

Sign In for Pricing
View Details
TMEM204 3'UTR Luciferase Stable Cell Line
TU025922 1.0 mL

TMEM204 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
C1orf35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0205507 1.0 µg DNA

C1orf35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details