Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C11orf17 (AKIP1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF808486 100 µg

C11orf17 (AKIP1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Cyclin H (CCNH) Rabbit Polyclonal Antibody
TA367485 100 µL

Cyclin H (CCNH) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Terizidone
TRC-T115500-25MG 25 mg

Terizidone

Sign In for Pricing
View Details
Human IGF-II R Protein, His Tag
IGR-H52H3-1mg 1 mg

Human IGF-II R Protein, His Tag

Sign In for Pricing
View Details
HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein
TP311201 20 µg

HNF1 alpha (HNF1A) (NM_000545) Human Recombinant Protein

Sign In for Pricing
View Details
BDNF (NM_001143813) Human Over-expression Lysate
LY428359 100 µg

BDNF (NM_001143813) Human Over-expression Lysate

Sign In for Pricing
View Details