Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73)

This Recombinant Human Probable non-functional T cell receptor beta variable 7-3 (TVB73) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 7-3 TRBV7-3

UniProt

A0A075B6L6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQTPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPKDRFFAVRPEGSVSTLKIQRTEQGDSAAYLRASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,3'-Bi-p-anisidine
TRC-B373495-50MG 50 mg

3,3'-Bi-p-anisidine

Sign In for Pricing
View Details
Butyl Sodium Sulfate
TRC-B693875-250MG 250 mg

Butyl Sodium Sulfate

Sign In for Pricing
View Details
4-Androsten-3beta,17beta-diol 17-Sulfate Sodium Salt
TRC-A102287-50MG 50 mg

4-Androsten-3beta,17beta-diol 17-Sulfate Sodium Salt

Sign In for Pricing
View Details
CIB1 Mouse Monoclonal Antibody [Clone ID: OTI1D7]
CF811149 100 µg

CIB1 Mouse Monoclonal Antibody [Clone ID: OTI1D7]

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF594 conjugate, 0.1mg/mL
BNC942444-500 1x 500 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2444), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®568 Tyramide
#92173 1x 500 µg

CF®568 Tyramide

Sign In for Pricing
View Details