Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2)

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2) spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASGEF1C (NM_175062) Human Recombinant Protein
TP311810L 1 mg

RASGEF1C (NM_175062) Human Recombinant Protein

Sign In for Pricing
View Details
Human TLR-2 (Toll-like Receptor 2) ELISA Kit
E-EL-H0951-01 24 Tests

Human TLR-2 (Toll-like Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Human TLR-2 (Toll-like Receptor 2) ELISA Kit
E-EL-H0951-02 48 Tests

Human TLR-2 (Toll-like Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Human TLR-2 (Toll-like Receptor 2) ELISA Kit
E-EL-H0951-03 96 Tests

Human TLR-2 (Toll-like Receptor 2) ELISA Kit

Sign In for Pricing
View Details
CRCP Rabbit Polyclonal Antibody
TA375071 100 µL

CRCP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-Linoleoyl-2-oleoyl-rac-glycerol
TRC-L468060-250MG 250 mg

1-Linoleoyl-2-oleoyl-rac-glycerol

Sign In for Pricing
View Details