Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2)

This Recombinant Human WAP four-disulfide core domain protein 2 (WFDC2) spans the amino acid sequence from region 31-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WAP four-disulfide core domain protein 2; Epididymal secretory protein E4; Major epididymis-specific protein E4; Putative protease inhibitor WAP5; WFDC2 HE4 WAP5

UniProt

Q14508

Expression Region

31-124

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAUS1P3 ORF Vector (Human) (pORF)
ORF020572 1.0 µg DNA

HAUS1P3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Neuron Specific Enolase (NSE) (FITC)
MBS6128244-01 0.1 mL

Neuron Specific Enolase (NSE) (FITC)

Sign In for Pricing
View Details
Neuron Specific Enolase (NSE) (FITC)
MBS6128244-02 5x 0.1 mL

Neuron Specific Enolase (NSE) (FITC)

Sign In for Pricing
View Details
N-Boc-N-bis (PEG2-OH)
OR1039574-01 100 mg

N-Boc-N-bis (PEG2-OH)

Sign In for Pricing
View Details
N-Boc-N-bis (PEG2-OH)
OR1039574-02 250 mg

N-Boc-N-bis (PEG2-OH)

Sign In for Pricing
View Details
N-Boc-N-bis (PEG2-OH)
OR1039574-03 1 g

N-Boc-N-bis (PEG2-OH)

Sign In for Pricing
View Details