Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Mouse (GST)

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Mouse (GST), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-mouse-gst.html

Purity

90.0

Smiles

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Molecular Formula

12512 (Gene_ID) P41731 (A103-I203) (Accession)

Molecular Weight

Approximately 38.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Receptor-Type Tyrosine-Protein Phosphatase C / CD45 (PTPRC) Antibody
abx016120 100 µL

Receptor-Type Tyrosine-Protein Phosphatase C / CD45 (PTPRC) Antibody

Sign In for Pricing
View Details
Mouse Dickkopf-related protein 2 ELISA Kit
orb1658564 96 Tests

Mouse Dickkopf-related protein 2 ELISA Kit

Sign In for Pricing
View Details
Tchp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4416806 1.0 µg DNA

Tchp sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
6-Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ol
ZDA89885-01 50 mg

6-Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ol

Sign In for Pricing
View Details
6-Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ol
ZDA89885-02 0.5 g

6-Methyl-7H-pyrrolo[2,3-d]pyrimidin-4-ol

Sign In for Pricing
View Details
PDK3 (A-4) AC
sc-365378 AC 500 µg/mL - 25% ag

PDK3 (A-4) AC

Sign In for Pricing
View Details