Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63, Mouse (GST)

The CD63 protein is an important cell surface receptor that activates multiple signaling cascades. It plays a role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Mouse (GST) is the recombinant mouse-derived CD63 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

CD63 Protein, Mouse (GST), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd63-protein-mouse-gst.html

Purity

90.0

Smiles

AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

Molecular Formula

12512 (Gene_ID) P41731 (A103-I203) (Accession)

Molecular Weight

Approximately 38.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tsc2 Mouse qPCR Primer Pair (NM_011647)
MP217683 200 Reactions

Tsc2 Mouse qPCR Primer Pair (NM_011647)

Sign In for Pricing
View Details
HnRNP C1/C2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61267R-BF594-01 20 µL

HnRNP C1/C2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
HnRNP C1/C2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61267R-BF594-02 100 µL

HnRNP C1/C2 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Nras Mouse Gene Knockout Kit (CRISPR)
KN511220 1 Kit

Nras Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Danio rerio Dual specificity protein phosphatase 22-A (dusp22a)
MBS1330165-01 0.02 mg (E-Coli)

Recombinant Danio rerio Dual specificity protein phosphatase 22-A (dusp22a)

Sign In for Pricing
View Details
Recombinant Danio rerio Dual specificity protein phosphatase 22-A (dusp22a)
MBS1330165-02 0.1 mg (E-Coli)

Recombinant Danio rerio Dual specificity protein phosphatase 22-A (dusp22a)

Sign In for Pricing
View Details