Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-1 alpha, Human (HEK293, Fc)

IL-1 alpha protein is located in cells and is a key cytokine connecting innate immunity and adaptive immunity. After binding to IL1R1 through IL1RAP, it forms a high-affinity receptor complex, initiates a signaling cascade with adapter molecules such as MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Human (HEK293, Fc) is the recombinant human-derived IL-1 alpha protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

IL-1 alpha Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-1-alpha-protein-human-hek293-fc.html

Purity

95.0

Smiles

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Molecular Formula

3552 (Gene_ID) P01583 (S113-A271) (Accession)

Molecular Weight

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF9 protein
80R-4344 20 ug

TNFRSF9 protein

Sign In for Pricing
View Details
SERPINB3 Polyclonal Antibody, Cy3 Conjugated
bs-9214R-Cy3 100 µL

SERPINB3 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Recombinant Human UPK3A protein
MBS1561693-01 0.05 mg

Recombinant Human UPK3A protein

Sign In for Pricing
View Details
Recombinant Human UPK3A protein
MBS1561693-02 0.1 mg

Recombinant Human UPK3A protein

Sign In for Pricing
View Details
Recombinant Human UPK3A protein
MBS1561693-03 5x 0.1 mg

Recombinant Human UPK3A protein

Sign In for Pricing
View Details
CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (Biotin)
MBS6248553-01 0.1 mL

CD1d (CD1d Antigen, CD1d Antigen D Polypeptide, R3, R3G1, Thymocyte Antigen CD1d) (Biotin)

Sign In for Pricing
View Details