Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBASH3A, Human (His)

UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UBASH3A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubash3a-protein-human-his.html

Purity

98.0

Smiles

ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN

Molecular Formula

53347 (Gene_ID) P57075-2 (A354-N623) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDB2 (NM_001130834) Human Over-expression Lysate
LY427279 100 µg

LDB2 (NM_001130834) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp946 Mouse Gene Knockout Kit (CRISPR)
KN520041 1 Kit

Zfp946 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ibuprofen Isopropyl Ester
TRC-I140090-1G 1 g

Ibuprofen Isopropyl Ester

Sign In for Pricing
View Details
Human Procollagen Lysine-1,2-Oxoglutarate-5-Dioxygenase 1 (PLOD1) ELISA Kit
RD-PLOD1-Hu-01 96 Tests

Human Procollagen Lysine-1,2-Oxoglutarate-5-Dioxygenase 1 (PLOD1) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen Lysine-1,2-Oxoglutarate-5-Dioxygenase 1 (PLOD1) ELISA Kit
RD-PLOD1-Hu-02 48 Tests

Human Procollagen Lysine-1,2-Oxoglutarate-5-Dioxygenase 1 (PLOD1) ELISA Kit

Sign In for Pricing
View Details
LIMPII Recombinant Rabbit Monoclonal Antibody [PSH03-25]
HA721967 100 µL

LIMPII Recombinant Rabbit Monoclonal Antibody [PSH03-25]

Sign In for Pricing
View Details