Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBASH3A, Human (His)

UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UBASH3A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ubash3a-protein-human-his.html

Purity

98.0

Smiles

ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN

Molecular Formula

53347 (Gene_ID) P57075-2 (A354-N623) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Son Mouse Gene Knockout Kit (CRISPR)
KN516468 1 Kit

Son Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE,  5nm
GAF-005-5 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE, 5nm

Sign In for Pricing
View Details
Recombinant SOCS2 Antibody
RC-4700-01 50 μL

Recombinant SOCS2 Antibody

Sign In for Pricing
View Details
Recombinant SOCS2 Antibody
RC-4700-02 100 µL

Recombinant SOCS2 Antibody

Sign In for Pricing
View Details
Recombinant SOCS2 Antibody
RC-4700-03 1 mL

Recombinant SOCS2 Antibody

Sign In for Pricing
View Details
PPP1R9B (NM_032595) Human Recombinant Protein
TP313696 20 µg

PPP1R9B (NM_032595) Human Recombinant Protein

Sign In for Pricing
View Details