Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Galectin-14/LGALS14, Human (His)

Galectin-14/LGALS14 protein has the ability to bind β-galactoside and lactose and can serve as an effective inducer of T cell apoptosis, highlighting its key role in the regulation of immune responses. Animal-Free Galectin-14/LGALS14 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-14/LGALS14 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Galectin-14/LGALS14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-galectin-14-lgals14-protein-human-his.html

Purity

98.00

Smiles

SSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Molecular Formula

56891 (Gene_ID) Q8TCE9-1 (S2-D139) (Accession)

Molecular Weight

Approximately 16.9 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone (6-5E-10B), CF740 conjugate, 0.1mg/mL
BNC740237-100 1x 100 µL

Progesterone (6-5E-10B), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF594 conjugate, 0.1mg/mL
BNC940324-500 1x 500 µL

CD53 (161-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PRKAG3 Antibody
RN-14515-01 50 μL

Recombinant PRKAG3 Antibody

Sign In for Pricing
View Details
Recombinant PRKAG3 Antibody
RN-14515-02 100 µL

Recombinant PRKAG3 Antibody

Sign In for Pricing
View Details
Recombinant PRKAG3 Antibody
RN-14515-03 1 mL

Recombinant PRKAG3 Antibody

Sign In for Pricing
View Details
Mouse Aqp2 activation kit by CRISPRa
GA200251 1 Kit

Mouse Aqp2 activation kit by CRISPRa

Sign In for Pricing
View Details