Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Mouse (HEK293, His)

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AGER Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-mouse-342a-a-hek293-his.html

Purity

98.0

Smiles

QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA

Molecular Formula

11596 (Gene_ID) Q62151-1/NP_031451.2 (Q24-A342) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41a (ITGA2B/1036), 0.2mg/mL
BNUB1036-500 1x 500 µL

CD41a (ITGA2B/1036), 0.2mg/mL

Sign In for Pricing
View Details
RPH3A Antibody (Biotin)
KB-7777-01 50 μL

RPH3A Antibody (Biotin)

Sign In for Pricing
View Details
RPH3A Antibody (Biotin)
KB-7777-02 100 µL

RPH3A Antibody (Biotin)

Sign In for Pricing
View Details
RPH3A Antibody (Biotin)
KB-7777-03 1 mL

RPH3A Antibody (Biotin)

Sign In for Pricing
View Details
Peroxiredoxin 6 (PRDX6) (NM_004905) Human Recombinant Protein
TP307780 20 µg

Peroxiredoxin 6 (PRDX6) (NM_004905) Human Recombinant Protein

Sign In for Pricing
View Details
Sodium Potassium ATPase (ATP1A1) (NM_001160233) Human Over-expression Lysate
LC431659 20 µg

Sodium Potassium ATPase (ATP1A1) (NM_001160233) Human Over-expression Lysate

Sign In for Pricing
View Details