Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AGER, Mouse (HEK293, His)

AGER proteins have multiple activities, including binding to S100 proteins, advanced glycation end products, and heparin. It is involved in cellular responses to amyloid, regulation of synaptic potentiation, and cytokine production. AGER Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

AGER Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ager-protein-mouse-342a-a-hek293-his.html

Purity

98.0

Smiles

QNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCVATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALA

Molecular Formula

11596 (Gene_ID) Q62151-1/NP_031451.2 (Q24-A342) (Accession)

Molecular Weight

Approximately 50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Cyclohexylcarbamoyl) -4-fluorophenylboronic acid
sc-288803 1 g

3- (Cyclohexylcarbamoyl) -4-fluorophenylboronic acid

Sign In for Pricing
View Details
Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit
MBS7618936-01 48 Well

Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit
MBS7618936-02 96 Well

Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit
MBS7618936-03 5x 96 Well

Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit
MBS7618936-04 10x 96 Well

Human MCM6 (minichromosome maintenance complex component 6) QuickTest ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Anti Saccharomyces cerevisiae antibody IgA Elisa kit
GTR10411574 96 Well

Guinea Pig Anti Saccharomyces cerevisiae antibody IgA Elisa kit

Sign In for Pricing
View Details