Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Mouse (His)

FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism.In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation.FABP5 Protein, Mouse (His) is the recombinant mouse-derived FABP5 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-e-fabp-protein-mouse-his.html

Purity

95.0

Smiles

MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ

Molecular Formula

16592 (Gene_ID) Q05816 (M1-Q135) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-01 0.02 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-02 0.02 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-03 0.1 mg (E-Coli)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-04 0.1 mg (Yeast)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-05 0.02 mg (Baculovirus)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)
MBS1358126-06 0.02 mg (Mammalian-Cell)

Recombinant Photorhabdus luminescens subsp. laumondii Tryptophan synthase beta chain (trpB)

Ask
View Details