Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FABP5, Mouse (His)

FABP5, also known as E-FABP, acts as an intracellular carrier of long-chain fatty acids and related lipids and regulates ligand metabolism.In addition to cytoplasmic transport, it selectively transports fatty acids to the nucleus, activates nuclear receptors, and delivers retinoic acid to promote proliferation.FABP5 Protein, Mouse (His) is the recombinant mouse-derived FABP5 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FABP5 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fabp5-e-fabp-protein-mouse-his.html

Purity

95.0

Smiles

MASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMAAMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRVYEKVQ

Molecular Formula

16592 (Gene_ID) Q05816 (M1-Q135) (Accession)

Molecular Weight

Approximately 16 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF10 Antibody - C-terminal region
MBS3216813-01 0.1 mL

ARHGEF10 Antibody - C-terminal region

Sign In for Pricing
View Details
ARHGEF10 Antibody - C-terminal region
MBS3216813-02 5x 0.1 mL

ARHGEF10 Antibody - C-terminal region

Sign In for Pricing
View Details
Human KAT2A/GCN5 antibody
ATGA0527-050 50 µL

Human KAT2A/GCN5 antibody

Sign In for Pricing
View Details
Rat MUS81 (Crossover junction endonuclease MUS81) ELISA Kit
ELI-16619r 96 Tests

Rat MUS81 (Crossover junction endonuclease MUS81) ELISA Kit

Sign In for Pricing
View Details
Anti-PATE3 Rabbit Polyclonal Antibody
TA323827 100 µL

Anti-PATE3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Epsin2, NT (Epsin 2, EPS-15 Interacting Protein 2, EPN2, KIAA1065)
MBS624192-01 0.2 mL

Epsin2, NT (Epsin 2, EPS-15 Interacting Protein 2, EPN2, KIAA1065)

Sign In for Pricing
View Details