Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cell surface-binding protein (E8L)

This Recombinant Cell surface-binding protein (E8L) spans the amino acid sequence from region 1-304. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell surface-binding protein, Carbonic anhydrase homolog

UniProt

Q8V4Y0

Expression Region

1-304

Source

In vitro E.coli expression system

Origin

Monkeypox virus

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIF LQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADA AWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSQRYSR EKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dcaf7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6329606 1.0 µg DNA

Dcaf7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
GPI ethanolamine phosphate transferase 1 (PIGN) Human ELISA Kit
D8146 96 Tests

GPI ethanolamine phosphate transferase 1 (PIGN) Human ELISA Kit

Sign In for Pricing
View Details
Prion Protein, aa109-112 (PrP, CD230) (MaxLight 550)
P8950-10-ML550 100 µL

Prion Protein, aa109-112 (PrP, CD230) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral mouse 1700023F06Rik shRNA (UAS) - Lentiviral mouse 1700023F06Rik shRNA (UAS, iRFP) plasmid
GTR15139684 1 Vial

Lentiviral mouse 1700023F06Rik shRNA (UAS) - Lentiviral mouse 1700023F06Rik shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NQO2 (NAD (P) H Dehydrogenase Quinone 2, DHQV, DIA6, NMOR2, NRH Dehydrogenase [Quinone] 2, NRH:quinone Oxidoreductase 2, Quinone Reductase 2, QR2 Ribosyldihydronicotinamide Dehydrogenase [Quinone]) (AP) discontinued
130522-AP 100 µL

NQO2 (NAD (P) H Dehydrogenase Quinone 2, DHQV, DIA6, NMOR2, NRH Dehydrogenase [Quinone] 2, NRH:quinone Oxidoreductase 2, Quinone Reductase 2, QR2 Ribosyldihydronicotinamide Dehydrogenase [Quinone]) (AP) discontinued

Sign In for Pricing
View Details
Edifenphos
sc-252772 250 mg

Edifenphos

Sign In for Pricing
View Details