Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Accessory secretory protein Asp4 (asp4)

This Recombinant Accessory secretory protein Asp4 (asp4) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Accessory secretory protein Asp4, Orf5

UniProt

Q4L2X3

Expression Region

1-60

Origin

Streptococcus gordonii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKDLFHKDIEGRLDELKHGKPKKEKASLGENLNKIFVIALGLMILIGLIFTLIGALRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NS 3763
TRC-N900568-2.5MG 2.5 mg

NS 3763

Sign In for Pricing
View Details
eIF3s8 (EIF3C) (NM_001037808) Human Over-expression Lysate
LC421989 20 µg

eIF3s8 (EIF3C) (NM_001037808) Human Over-expression Lysate

Sign In for Pricing
View Details
ZBTB3 (NM_024784) Human Over-expression Lysate
LC403029 20 µg

ZBTB3 (NM_024784) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human FRZB/sFRP-3 Protein (His Tag)
PKSH031646 50 µg

Recombinant Human FRZB/sFRP-3 Protein (His Tag)

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL
BNC041860-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nesvacumab Biosimilar - Research Grade
ICH5010-100mg 100 mg

Nesvacumab Biosimilar - Research Grade

Sign In for Pricing
View Details