Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Accessory secretory protein Asp4 (asp4)

This Recombinant Accessory secretory protein Asp4 (asp4) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Accessory secretory protein Asp4, Orf5

UniProt

Q4L2X3

Expression Region

1-60

Origin

Streptococcus gordonii

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKDLFHKDIEGRLDELKHGKPKKEKASLGENLNKIFVIALGLMILIGLIFTLIGALRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFPI Mouse Monoclonal Antibody [Clone ID: OTI3C2]
CF805998 100 µg

TFPI Mouse Monoclonal Antibody [Clone ID: OTI3C2]

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), Biotin conjugate, 0.1mg/mL
BNCB0880-100 1x 100 µL

P57 / KIP2 (KIP2/880), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Handheld Spectrophotometer BHSP-901
BHSP-901 1 Unit

Handheld Spectrophotometer BHSP-901

Sign In for Pricing
View Details
IFluor® 860-streptavidin conjugate
16979-AAT 200 µg

IFluor® 860-streptavidin conjugate

Sign In for Pricing
View Details
SETDB2 (NM_001160308) Human Over-expression Lysate
LC432029 20 µg

SETDB2 (NM_001160308) Human Over-expression Lysate

Sign In for Pricing
View Details
Desacetyl Cephapirin Sodium Salt
TRC-D288970-2.5MG 2.5 mg

Desacetyl Cephapirin Sodium Salt

Sign In for Pricing
View Details