Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative small membrane protein NID67 (Nid67)

This Recombinant Mouse Putative small membrane protein NID67 (Nid67) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Putative small membrane protein NID67, NGF-induced differentiation clone 67 protein

UniProt

Q99PE5

Expression Region

1-60

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
RD-GDNF-Ra-01 96 Tests

Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit
RD-GDNF-Ra-02 48 Tests

Rat Glial Cell Line Derived Neurotrophic Factor (GDNF) ELISA Kit

Sign In for Pricing
View Details
CF®680 Azide
#92119 1x 500 µg

CF®680 Azide

Sign In for Pricing
View Details
Human C14orf148 (NOXRED1) activation kit by CRISPRa
GA114792 1 Kit

Human C14orf148 (NOXRED1) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse SCF Antibody Pair Set
E-KAB-0335 50 µL & 100 µg

Mouse SCF Antibody Pair Set

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF647 conjugate, 0.1mg/mL
BNC471909-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details