Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Putative small membrane protein NID67 (Nid67)

This Recombinant Mouse Putative small membrane protein NID67 (Nid67) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Putative small membrane protein NID67, NGF-induced differentiation clone 67 protein

UniProt

Q99PE5

Expression Region

1-60

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAITQSPVDAVLPKHILDIWAIVLIILATIVIMTSLFLCPATAVIIYRMRTHPVLNGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SFXN3 activation kit by CRISPRa
GA113137 1 Kit

Human SFXN3 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A HMBA
HA12516014.25G 25 g

Polystyrene A HMBA

Sign In for Pricing
View Details
Human OR6P1 activation kit by CRISPRa
GA115038 1 Kit

Human OR6P1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse Il6RA/CD126 protein (His tag)
PDMM100024-01 20 µg

Recombinant Mouse Il6RA/CD126 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Il6RA/CD126 protein (His tag)
PDMM100024-02 100 µg

Recombinant Mouse Il6RA/CD126 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse Il6RA/CD126 protein (His tag)
PDMM100024-03 500 µg

Recombinant Mouse Il6RA/CD126 protein (His tag)

Sign In for Pricing
View Details