Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Putative small membrane protein NID67 (Nid67)

This Recombinant Rat Putative small membrane protein NID67 (Nid67) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Putative small membrane protein NID67, NGF-induced differentiation clone 67 protein

UniProt

Q99PE6

Expression Region

1-60

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAISQSPVDVLLPKHILDIWAIVLIILATVVIMTSLFLCPATAVIIYRMRTHPVLNGAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grk3 Mouse Gene Knockout Kit (CRISPR)
KN500937 1 Kit

Grk3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 19 (BA17), CF640R conjugate, 0.1mg/mL
BNC400666-500 1x 500 µL

Cytokeratin 19 (BA17), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBCC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]
TA504687BM 100 µL

TBCC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1F2]

Sign In for Pricing
View Details
RAB8B (NM_016530) Human Recombinant Protein
TP304651 20 µg

RAB8B (NM_016530) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP534954 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
2-(4-Aminophenylthio)acetic Acid
TRC-A292355-2G 2 g

2-(4-Aminophenylthio)acetic Acid

Sign In for Pricing
View Details