Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C737

Expression Region

1-60

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT3 Human Gene Knockout Kit (CRISPR)
KN221051LP 1 Kit

AKT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S-(2-Hydroxyethyl)glutathione-d4 Hydrochloride
TRC-H942157-1MG 1 mg

S-(2-Hydroxyethyl)glutathione-d4 Hydrochloride

Sign In for Pricing
View Details
Air Cooled Chiller BCHI-104
BCHI-104 Each

Air Cooled Chiller BCHI-104

Sign In for Pricing
View Details
GLB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]
TA505544BM 100 µL

GLB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]

Sign In for Pricing
View Details
3,3-Bis(2-hydroxyethyl)urea
TRC-B444220-10MG 10 mg

3,3-Bis(2-hydroxyethyl)urea

Sign In for Pricing
View Details
Transmembrane protein 88B (TMEM88B) (NM_001146685) Human Over-expression Lysate
LY431124 100 µg

Transmembrane protein 88B (TMEM88B) (NM_001146685) Human Over-expression Lysate

Sign In for Pricing
View Details