Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C737

Expression Region

1-60

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnr Mouse Gene Knockout Kit (CRISPR)
KN518030 1 Kit

Tnr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXO4 Rabbit Polyclonal Antibody
AP02683PU-S 50 µL

FOXO4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp622 Mouse Gene Knockout Kit (CRISPR)
KN519912 1 Kit

Zfp622 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Formyl Linagliptin
TRC-F700670-50MG 50 mg

N-Formyl Linagliptin

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562911 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561856 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details