Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C737

Expression Region

1-60

Origin

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC SIGN (CD209) Rabbit Polyclonal Antibody
TA371719 100 µL

DC SIGN (CD209) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Pentylfuran-d11
TRC-P284954-5MG 5 mg

2-Pentylfuran-d11

Sign In for Pricing
View Details
Microplate Shaker BSTH-111
BSTH-111 1 Unit

Microplate Shaker BSTH-111

Sign In for Pricing
View Details
Human OR51Q1 activation kit by CRISPRa
GA118100 1 Kit

Human OR51Q1 activation kit by CRISPRa

Sign In for Pricing
View Details
ASS1 Mouse Monoclonal Antibody [11F1]
EM1701-87 100 µL

ASS1 Mouse Monoclonal Antibody [11F1]

Sign In for Pricing
View Details
Dynll2 (NM_026556) Mouse Tagged ORF Clone
MG200217 10 µg

Dynll2 (NM_026556) Mouse Tagged ORF Clone

Sign In for Pricing
View Details