Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C739

Expression Region

1-60

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Interleukin-6 (IL6) antibody *Mouse anti-human, monoclonal IgG1*
V100135-AAT 50 µg

Anti-Interleukin-6 (IL6) antibody *Mouse anti-human, monoclonal IgG1*

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (P479S) (His Tag)
PKSV030452 100 µg

Recombinant SARS-CoV-2 Spike RBD (P479S) (His Tag)

Sign In for Pricing
View Details
CLOCK Rabbit Polyclonal Antibody
AP06636PU-N 100 µg

CLOCK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Leucyl-D-leucine
TRC-L321020-2MG 2 mg

L-Leucyl-D-leucine

Sign In for Pricing
View Details
ZNF205 (NM_003456) Human Recombinant Protein
TP761639 50 µg

ZNF205 (NM_003456) Human Recombinant Protein

Sign In for Pricing
View Details
Picaridin-d3
TRC-P436002-1MG 1 mg

Picaridin-d3

Sign In for Pricing
View Details