Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C739

Expression Region

1-60

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2A6 (CYP2A6) Human Gene Knockout Kit (CRISPR)
KN422995 1 Kit

Cytochrome P450 2A6 (CYP2A6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VC pBR 322/ Hae III Marker, 5 x 50µg
NM2430 5 x 50μg

VC pBR 322/ Hae III Marker, 5 x 50µg

Sign In for Pricing
View Details
SLC44A4 Mouse Monoclonal Antibody [3-F2]
HA600017 100 µL

SLC44A4 Mouse Monoclonal Antibody [3-F2]

Sign In for Pricing
View Details
(3alpha,5alpha)-3,17-Dihydroxypregnan-20-one
TRC-D863770-50MG 50 mg

(3alpha,5alpha)-3,17-Dihydroxypregnan-20-one

Sign In for Pricing
View Details
EIF4B Rabbit Polyclonal Antibody
AP11772PU-N 400 µL

EIF4B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PDE3A activation kit by CRISPRa
GA103436 1 Kit

Human PDE3A activation kit by CRISPRa

Sign In for Pricing
View Details