Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a)

This Recombinant Epstein-Barr virus Protein BNLF2a (BNLF2a) spans the amino acid sequence from region 1-60.

Product Specifications

Product Name Alternative

Protein BNLF2a

UniProt

P0C739

Expression Region

1-60

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hydroxydecanedioic Acid
TRC-H939450-50MG 50 mg

2-Hydroxydecanedioic Acid

Sign In for Pricing
View Details
Mouse ACE, Tag Free
HA211125-01 20 µg

Mouse ACE, Tag Free

Sign In for Pricing
View Details
Mouse ACE, Tag Free
HA211125-02 50 µg

Mouse ACE, Tag Free

Sign In for Pricing
View Details
Mouse ACE, Tag Free
HA211125-03 100 µg

Mouse ACE, Tag Free

Sign In for Pricing
View Details
EXT1 Human Gene Knockout Kit (CRISPR)
KN200644RB 1 Kit

EXT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF640R conjugate, 0.1mg/mL
BNC400730-100 1x 100 µL

HSP60 (GROEL/730), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details