Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjzD

UniProt

O34713

Expression Region

1-61

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQ H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADPRM (NM_020233) Human Recombinant Protein
TP313957L 1 mg

ADPRM (NM_020233) Human Recombinant Protein

Sign In for Pricing
View Details
Cathepsin D Recombinant Rabbit monoclonal Antibody
HA750152 100 µL

Cathepsin D Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ttc8 Mouse Gene Knockout Kit (CRISPR)
KN518428 1 Kit

Ttc8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-(2-Nitrophenyl)morpholin-3-one
TRC-N926065-500MG 500 mg

4-(2-Nitrophenyl)morpholin-3-one

Sign In for Pricing
View Details
CD74 (LN-2), 0.2mg/mL
BNUB0056-100 1x 100 µL

CD74 (LN-2), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human CD7/GP40 Protein (His Tag)
PKSH032223-01 10 µg

Recombinant Human CD7/GP40 Protein (His Tag)

Sign In for Pricing
View Details