Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjzD

UniProt

O34713

Expression Region

1-61

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQ H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP3A7-CYP3A51P Mouse Monoclonal Antibody [Clone ID: F19 P2 H2]
AM05373PU-N 200 µg

CYP3A7-CYP3A51P Mouse Monoclonal Antibody [Clone ID: F19 P2 H2]

Sign In for Pricing
View Details
Monoclonal Antibody to TLR6 (Clone: ABM1B50) -FITC Conjugated
10-3002-F-25 25 µg

Monoclonal Antibody to TLR6 (Clone: ABM1B50) -FITC Conjugated

Sign In for Pricing
View Details
Tristearin
TRC-T886450-50MG 50 mg

Tristearin

Sign In for Pricing
View Details
Adenosine 5'-Diphosphate Sodium Salt
TRC-A281708-25G 25 g

Adenosine 5'-Diphosphate Sodium Salt

Sign In for Pricing
View Details
Human CTRP3 (C1QTNF3) activation kit by CRISPRa
GA114488 1 Kit

Human CTRP3 (C1QTNF3) activation kit by CRISPRa

Sign In for Pricing
View Details
Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI2F9]
CF809187 100 µg

Transglutaminase 2 (TGM2) Mouse Monoclonal Antibody [Clone ID: OTI2F9]

Sign In for Pricing
View Details