Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjzD (yjzD) spans the amino acid sequence from region 1-61.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjzD

UniProt

O34713

Expression Region

1-61

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYIIAFIWTFLLSHMACYLVASMNSVTYNFKTSSVIAVVLYVLIMVLAEIMPMNKNASQ H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Trefoil Factor 2 (TFF2) ELISA Kit
RDR-TFF2-Ra-01 96 Tests

Rat Trefoil Factor 2 (TFF2) ELISA Kit

Sign In for Pricing
View Details
Rat Trefoil Factor 2 (TFF2) ELISA Kit
RDR-TFF2-Ra-02 48 Tests

Rat Trefoil Factor 2 (TFF2) ELISA Kit

Sign In for Pricing
View Details
PCBP3 (NM_020528) Human Recombinant Protein
TP329176L 1 mg

PCBP3 (NM_020528) Human Recombinant Protein

Sign In for Pricing
View Details
Desalkyl Ebastine
TRC-D288770-5MG 5 mg

Desalkyl Ebastine

Sign In for Pricing
View Details
FNDC3B Human Gene Knockout Kit (CRISPR)
KN206911BN 1 Kit

FNDC3B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Triethylene Glycol Ditosylate
TRC-E917743-500MG 500 mg

Triethylene Glycol Ditosylate

Sign In for Pricing
View Details